VPREB3 purified MaxPab mouse polyclonal antibody (B01P) View larger

VPREB3 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of VPREB3 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,WB-Tr

More info about VPREB3 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00029802-B01P
Product name: VPREB3 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human VPREB3 protein.
Gene id: 29802
Gene name: VPREB3
Gene alias: 8HS20|N27C7-2
Gene description: pre-B lymphocyte 3
Genbank accession: NM_013378.1
Immunogen: VPREB3 (NP_037510.1, 1 a.a. ~ 123 a.a) full-length human protein.
Immunogen sequence/protein sequence: MACRCLSFLLMGTFLSVSQTVLAQLDALLVFPGQVAQLSCTLSPQHVTIRDYGVSWYQQRAGSAPRYLLYYRSEEDHHRPADIPDRFSAAKDEAHNACVLTISPVQPEDDADYYCSVGYGFSP
Protein accession: NP_037510.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00029802-B01P-13-15-1.jpg
Application image note: Western Blot analysis of VPREB3 expression in transfected 293T cell line (H00029802-T02) by VPREB3 MaxPab polyclonal antibody.

Lane 1: VPREB3 transfected lysate(13.53 KDa).
Lane 2: Non-transfected lysate.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy VPREB3 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart