| Brand: | Abnova |
| Reference: | H00029766-M10 |
| Product name: | TMOD3 monoclonal antibody (M10), clone 1E1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TMOD3. |
| Clone: | 1E1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 29766 |
| Gene name: | TMOD3 |
| Gene alias: | UTMOD |
| Gene description: | tropomodulin 3 (ubiquitous) |
| Genbank accession: | NM_014547 |
| Immunogen: | TMOD3 (NP_055362, 280 a.a. ~ 352 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RDNETLAELKIDNQRQQLGTAVELEMAKMLEENTNILKFGYQFTQQGPRTRAANAITKNNDLVRKRRVEGDHQ |
| Protein accession: | NP_055362 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.77 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | TMOD3 monoclonal antibody (M10), clone 1E1. Western Blot analysis of TMOD3 expression in human kidney. |
| Applications: | WB-Ti,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |