Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of UHRF1 monoclonal antibody (M01), clone 3A11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
More info about UHRF1 monoclonal antibody (M01), clone 3A11
| Brand: | Abnova |
| Reference: | H00029128-M01 |
| Product name: | UHRF1 monoclonal antibody (M01), clone 3A11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant UHRF1. |
| Clone: | 3A11 |
| Isotype: | IgG1 Kappa |
| Gene id: | 29128 |
| Gene name: | UHRF1 |
| Gene alias: | FLJ21925|ICBP90|MGC138707|Np95|RNF106|hNP95 |
| Gene description: | ubiquitin-like with PHD and ring finger domains 1 |
| Genbank accession: | NM_013282 |
| Immunogen: | UHRF1 (NP_037414, 694 a.a. ~ 793 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | WNEVLASLKDRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLFPGYGNGR |
| Protein accession: | NP_037414 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | UHRF1 monoclonal antibody (M01), clone 3A11 Western Blot analysis of UHRF1 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Interplay between Np95 and Eme1 in the DNA damage response.Mistry H, Gibson L, Yun JW, Sarras H, Tamblyn L, McPherson JP. Biochem Biophys Res Commun. 2008 Oct 24;375(3):321-5. Epub 2008 Aug 8. |