Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CLEC2D monoclonal antibody (M03), clone 2E11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about CLEC2D monoclonal antibody (M03), clone 2E11
| Brand: | Abnova |
| Reference: | H00029121-M03 |
| Product name: | CLEC2D monoclonal antibody (M03), clone 2E11 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant CLEC2D. |
| Clone: | 2E11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 29121 |
| Gene name: | CLEC2D |
| Gene alias: | CLAX|LLT1|OCIL |
| Gene description: | C-type lectin domain family 2, member D |
| Genbank accession: | BC019883 |
| Immunogen: | CLEC2D (AAH19883, 1 a.a. ~ 154 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MHDSNNVEKDITPSELPANPGCVHSKEHSIKATLIWRLFFLIMFLTIIVCGMVAALSAIRANCHQEPSVCLQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQGQPWKWINGTEWTRQ |
| Protein accession: | AAH19883 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (42.68 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Vaccinia Virus WR induces rapid surface expression of a host molecule detected by the antibody 4C7 that is distinct from CLEC2D.Williams KJ, Eaton HE, Jones L, Rengan S, Burshtyn DN. Microbiol Immunol. 2016 Nov;60(11):754-769. |