Brand: | Abnova |
Reference: | H00029108-B01P |
Product name: | PYCARD purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human PYCARD protein. |
Gene id: | 29108 |
Gene name: | PYCARD |
Gene alias: | ASC|CARD5|MGC10332|TMS|TMS-1|TMS1 |
Gene description: | PYD and CARD domain containing |
Genbank accession: | BC013569 |
Immunogen: | PYCARD (AAH13569, 1 a.a. ~ 149 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MDALDLTDKLVSFYLETYGAELTANVLRDMGLQEMAGQLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRAALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFNFTPAWNWTCKDLLLQALRESQSYLVEDLERS |
Protein accession: | - |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | PYCARD MaxPab polyclonal antibody. Western Blot analysis of PYCARD expression in MCF-7. |
Applications: | WB-Ce,WB-Ti,WB-Tr |
Shipping condition: | Dry Ice |