| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr,IP |
| Brand: | Abnova |
| Reference: | H00029089-M02 |
| Product name: | UBE2T monoclonal antibody (M02), clone 4G1-4C2 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant UBE2T. |
| Clone: | 4G1-4C2 |
| Isotype: | IgG2b Kappa |
| Gene id: | 29089 |
| Gene name: | UBE2T |
| Gene alias: | HSPC150|PIG50 |
| Gene description: | ubiquitin-conjugating enzyme E2T (putative) |
| Genbank accession: | BC004152 |
| Immunogen: | UBE2T (AAH04152, 1 a.a. ~ 197 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV |
| Protein accession: | AAH04152 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (47.41 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of UBE2T expression in transfected 293T cell line by UBE2T monoclonal antibody (M02), clone 4G1-4C2. Lane 1: UBE2T transfected lysate(22.5 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |