| Brand: | Abnova |
| Reference: | H00028996-M03 |
| Product name: | HIPK2 monoclonal antibody (M03), clone 1F10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HIPK2. |
| Clone: | 1F10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 28996 |
| Gene name: | HIPK2 |
| Gene alias: | DKFZp686K02111|FLJ23711|PRO0593 |
| Gene description: | homeodomain interacting protein kinase 2 |
| Genbank accession: | AF208291 |
| Immunogen: | HIPK2 (AAG41236.1, 961 a.a. ~ 1065 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TGNPRTIIVPPLKTQASEVLVECDSLVPVNTSHHSSSYKSKSSSNVTSTSGHSSGSSSGAITYRQQRPGPHFQQQQPLNLSQAQQHITTDRTGSHRRQQAYITPT |
| Protein accession: | AAG41236.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to HIPK2 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 1 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |