| Brand: | Abnova |
| Reference: | H00028984-M01 |
| Product name: | C13orf15 monoclonal antibody (M01), clone 3B9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant C13orf15. |
| Clone: | 3B9 |
| Isotype: | IgG1 Kappa |
| Gene id: | 28984 |
| Gene name: | C13orf15 |
| Gene alias: | KIAA0564|MGC87338|RGC-32|RGC32|bA157L14.2 |
| Gene description: | chromosome 13 open reading frame 15 |
| Genbank accession: | NM_014059 |
| Immunogen: | C13orf15 (NP_054778.1, 1 a.a. ~ 117 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MKPPAEDLSDALCEFDAVLADFASPFHERHFHYEEHLERMKRRSSASVSDSSGFSDSESADSLYRNSFSFSDEKLNSPTDSTPALLSATVTPQKAKLGDTKELEAFIADLDKTLASM |
| Protein accession: | NP_054778.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged C13orf15 is 0.03 ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |