Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 395,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 395,00 €
Data sheet of FLVCR monoclonal antibody (M05), clone 4B2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
More info about FLVCR monoclonal antibody (M05), clone 4B2
| Brand: | Abnova |
| Reference: | H00028982-M05 |
| Product name: | FLVCR monoclonal antibody (M05), clone 4B2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant FLVCR. |
| Clone: | 4B2 |
| Isotype: | IgG2b Kappa |
| Gene id: | 28982 |
| Gene name: | FLVCR1 |
| Gene alias: | FLVCR |
| Gene description: | feline leukemia virus subgroup C cellular receptor 1 |
| Genbank accession: | NM_014053 |
| Immunogen: | FLVCR (NP_054772, 1 a.a. ~ 83 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MARPDDEEGAAVAPGHPLAKGYLPLPRGAPVGKESVELQNGPKAGTFPVNGAPRDSLAAASGVLGGPQTPLAPEEETQARLLP |
| Protein accession: | NP_054772 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.87 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western blot analysis of FLVCR over-expressed 293 cell line, cotransfected with FLVCR Validated Chimera RNAi ( Cat # H00028982-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with FLVCR monoclonal antibody (M05), clone 4B2 (Cat # H00028982-M05 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |
| Publications: | Heme-Oxygenases during Erythropoiesis in K562 and Human Bone Marrow Cells.Alves LR, Costa ES, Sorgine MH, Nascimento-Silva MC, Teodosio C, Barcena P, Castro-Faria-Neto HC, Bozza PT, Orfao A, Oliveira PL, Maya-Monteiro CM. PLoS One. 2011;6(7):e21358. Epub 2011 Jul 13. |