No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA |
Brand: | Abnova |
Reference: | H00028978-A01 |
Product name: | TMEM14A polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a full-length recombinant TMEM14A. |
Gene id: | 28978 |
Gene name: | TMEM14A |
Gene alias: | C6orf73|PTD011 |
Gene description: | transmembrane protein 14A |
Genbank accession: | BC015097 |
Immunogen: | TMEM14A (AAH15097, 1 a.a. ~ 99 a.a) full-length recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MDLIGFGYAALVTFGSIFGYKRRGGVPSLIAGLFVGCLAGYGAYRVSNDKRDVKVSLFTAFFLATIMGVRFKRSKKIMPAGLVAGLSLMMILRLVLLLL |
Protein accession: | AAH15097 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |