Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00028973-B01P |
Product name: | MRPS18B purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human MRPS18B protein. |
Gene id: | 28973 |
Gene name: | MRPS18B |
Gene alias: | C6orf14|DKFZp564H0223|HSPC183|HumanS18a|MRP-S18-2|MRPS18-2|PTD017|S18amt |
Gene description: | mitochondrial ribosomal protein S18B |
Genbank accession: | BC005373 |
Immunogen: | MRPS18B (AAH05373, 1 a.a. ~ 258 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MAASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEEDSLSSVPISPYKDEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRNVKLLEQFVCAHTGIIFYAPYTGVCVKQHKRLTQAIQKARDHGLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSSDPWYPWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMPKMPPRTPAEASSTGQTGPQSAL |
Protein accession: | AAH05373 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of MRPS18B expression in transfected 293T cell line (H00028973-T01) by MRPS18B MaxPab polyclonal antibody. Lane 1: MRPS18B transfected lysate(28.49 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |