Brand: | Abnova |
Reference: | H00028968-M13 |
Product name: | SLC6A16 monoclonal antibody (M13), clone 2E5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC6A16. |
Clone: | 2E5 |
Isotype: | IgG1 Kappa |
Gene id: | 28968 |
Gene name: | SLC6A16 |
Gene alias: | NTT5 |
Gene description: | solute carrier family 6, member 16 |
Genbank accession: | NM_014037 |
Immunogen: | SLC6A16 (NP_054756.2, 406 a.a. ~ 492 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RCCERNAEILLKLINLGKLPPDAKPPVNLLYNPTSIYNAWLSGLPQHIKSMVLREVTECNIETQFLKASEGPKFAFLSFVEAMSFLP |
Protein accession: | NP_054756.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.31 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged SLC6A16 is 1 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |