Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of REM1 monoclonal antibody (M02), clone 3A9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about REM1 monoclonal antibody (M02), clone 3A9
| Brand: | Abnova |
| Reference: | H00028954-M02 |
| Product name: | REM1 monoclonal antibody (M02), clone 3A9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant REM1. |
| Clone: | 3A9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 28954 |
| Gene name: | REM1 |
| Gene alias: | GD:REM|GES|MGC48669|REM |
| Gene description: | RAS (RAD and GEM)-like GTP-binding 1 |
| Genbank accession: | NM_014012 |
| Immunogen: | REM1 (NP_054731, 162 a.a. ~ 251 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SIADRGSFESASELRIQLRRTHQADHVPIILVGNKADLARCREVSVEEGRACAVVFDCKFIETSATLQHNVAELFEGVVRQLRLRRRDSA |
| Protein accession: | NP_054731 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |