Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TRIB2 monoclonal antibody (M04), clone 1B1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
More info about TRIB2 monoclonal antibody (M04), clone 1B1
| Brand: | Abnova |
| Reference: | H00028951-M04 |
| Product name: | TRIB2 monoclonal antibody (M04), clone 1B1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TRIB2. |
| Clone: | 1B1 |
| Isotype: | IgG2b Lambda |
| Gene id: | 28951 |
| Gene name: | TRIB2 |
| Gene alias: | C5FW|GS3955|TRB2 |
| Gene description: | tribbles homolog 2 (Drosophila) |
| Genbank accession: | NM_021643 |
| Immunogen: | TRIB2 (NP_067675, 254 a.a. ~ 343 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | FHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQEILDHPWFSTDFSVSNSAYGAKEVSDQLVPDVNMEENLDPFFN |
| Protein accession: | NP_067675 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to TRIB2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |
| Publications: | TRIB2 inhibits Wnt/β-Catenin/TCF4 signaling through its associated Ubiquitin E3 ligases, β-TrCP, COP1 and Smurf1, in liver cancer cells.Xu S, Tong M, Huang J, Zhang Y, Qiao Y, Weng W, Liu W, Wang J, Sun F FEBS Lett. 2014 Oct 11. pii: S0014-5793(14)00720-0. doi: 10.1016/j.febslet.2014.09.042. |