> >>IGLV3-25 (Human) Recombinant Protein (P01)
IGLV3-25 (Human) Recombinant Protein (P01) View larger

IGLV3-25 (Human) Recombinant Protein (P01)

New product

199,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language
Rate it

Data sheet of IGLV3-25 (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Origin speciesHuman
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about IGLV3-25 (Human) Recombinant Protein (P01)

Reference: H00028793-P01
Product name: IGLV3-25 (Human) Recombinant Protein (P01)
Product description: Human IGLV3-25 full-length ORF ( AAH89418.1, 1 a.a. - 233 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 28793
Gene name: IGLV3-25
Gene alias: IGLV325|MGC105005|V2-17
Gene description: immunoglobulin lambda variable 3-25
Genbank accession: BC089418.1
Immunogen sequence/protein sequence: MAWIPLLLPLLTLCTGSEASYELTQPPSVSVSPGQTARITCSADALPKQYAYWYQQKPGQAPVLVIYKDSERPSGIPERFSGSSSGTTVTLTISGVQAEDEADYYCQSADTSGTYVVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Protein accession: AAH89418.1
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Shipping condition: Dry Ice

Reviews

Buy IGLV3-25 (Human) Recombinant Protein (P01) now

Add to cart