IGLV6-57 (Human) Recombinant Protein (P01) View larger

IGLV6-57 (Human) Recombinant Protein (P01)

New product

527,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IGLV6-57 (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about IGLV6-57 (Human) Recombinant Protein (P01)

Brand: Abnova
Reference: H00028778-P01
Product name: IGLV6-57 (Human) Recombinant Protein (P01)
Product description: Human IGLV6-57 full-length ORF ( AAH23973.1, 1 a.a. - 148 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 28778
Gene name: IGLV6-57
Gene alias: IGLV657|MGC34845|V1-22
Gene description: immunoglobulin lambda variable 6-57
Genbank accession: BC023973.1
Immunogen sequence/protein sequence: MAWAPLLLTLLAHCTGSWANFMLTQPHSVSESPGKTVTISCTRSSGSIASNYVQWYQQRPGRAPTTVIYEDNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDSSNHTVLQTHGEVRQKLPRASLPGPVSACLHRRG
Protein accession: AAH23973.1
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00028778-P01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy IGLV6-57 (Human) Recombinant Protein (P01) now

Add to cart