| Brand: | Abnova |
| Reference: | H00028513-A01 |
| Product name: | CDH19 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant CDH19. |
| Gene id: | 28513 |
| Gene name: | CDH19 |
| Gene alias: | CDH7|CDH7L2 |
| Gene description: | cadherin 19, type 2 |
| Genbank accession: | NM_021153 |
| Immunogen: | CDH19 (NP_066976, 231 a.a. ~ 340 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | GQPGALSGTTSVLIKLSDVNDNKPIFKESLYRLTVSESAPTGTSIGTIMAYDNDIGENAEMDYSIEEDDSQTFDIITNHETQEGIVILKKKVDFEHQNHYGIRAKVKNHH |
| Protein accession: | NP_066976 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Monocyte chemotactic protein-1 promotes angiogenesis via a novel transcription factor MCPIP.Niu J, Azfer A, Zhelyabovska O, Fatma S, Kolattukudy PE. J Biol Chem. 2008 May 23;283(21):14542-51. Epub 2008 Mar 24. |