Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NKIRAS2 monoclonal antibody (M02), clone 2G9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
More info about NKIRAS2 monoclonal antibody (M02), clone 2G9
| Brand: | Abnova |
| Reference: | H00028511-M02 |
| Product name: | NKIRAS2 monoclonal antibody (M02), clone 2G9 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant NKIRAS2. |
| Clone: | 2G9 |
| Isotype: | IgG1 Kappa |
| Gene id: | 28511 |
| Gene name: | NKIRAS2 |
| Gene alias: | DKFZp434N1526|KBRAS2|MGC74742|kappaB-Ras2 |
| Gene description: | NFKB inhibitor interacting Ras-like 2 |
| Genbank accession: | BC007450 |
| Immunogen: | NKIRAS2 (AAH07450, 1 a.a. ~ 191 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQVRFYDTRGLRDGAELPRHCFSCTDGYVLVYSTDSRESFQRVELLKKEIDKSKDKKEVTIVVLGNKCDLQEQRRVDPDVAQHWAKSEKVKLWEVSVADRRSLLEPFVYLASKMTQPQSKSAFPLSRKNKGSGSLDG |
| Protein accession: | AAH07450 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (46.75 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to NKIRAS2 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Estradiol suppresses NF-kappaB activation through coordinated regulation of let-7a and miR-125b in primary human macrophages.Murphy AJ, Guyre PM, Pioli PA. J Immunol. 2010 May 1;184(9):5029-37. Epub 2010 Mar 29. |