Cart 66 Product Products 20 988,54 € (empty)
No products
To be determined Shipping
20 988,54 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 66 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 20 988,54 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 20 988,54 €
Data sheet of EML4 monoclonal antibody (M01), clone 3C10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,S-ELISA,ELISA,WB-Re |
More info about EML4 monoclonal antibody (M01), clone 3C10
| Brand: | Abnova |
| Reference: | H00027436-M01 |
| Product name: | EML4 monoclonal antibody (M01), clone 3C10 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant EML4. |
| Clone: | 3C10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 27436 |
| Gene name: | EML4 |
| Gene alias: | C2orf2|DKFZp686P18118|ELP120|FLJ10942|FLJ32318|ROPP120 |
| Gene description: | echinoderm microtubule associated protein like 4 |
| Genbank accession: | BC008685 |
| Immunogen: | EML4 (AAH08685, 1 a.a. ~ 62 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MCYTPCKKYTDMNRQFLEKKEHFFKYLGNTALSDQQGVYLRTSVTFGVAMYNEIYNHDTLRW |
| Protein accession: | AAH08685 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (32.56 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to EML4 on formalin-fixed paraffin-embedded human prostate cancer. [antibody concentration 10 ug/ml] |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Expression analysis of EML4 in normal lung tissue and non-small cell lung cancer (NSCLC) in the absence and presence of chemotherapeutics.Radtke J, Rezaie SG, Kugler Ch, Zabel P, Schultz H, Vollmer E, Goldmann T, Lang DS. Rom J Morphol Embryol. 2010;51(4):647-53. |