| Brand: | Abnova |
| Reference: | H00027429-Q01 |
| Product name: | PRSS25 (Human) Recombinant Protein (Q01) |
| Product description: | Human PRSS25 partial ORF ( AAH00096, 359 a.a. - 458 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 27429 |
| Gene name: | HTRA2 |
| Gene alias: | OMI|PARK13|PRSS25 |
| Gene description: | HtrA serine peptidase 2 |
| Genbank accession: | BC000096 |
| Immunogen sequence/protein sequence: | RRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE |
| Protein accession: | AAH00096 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quality control testing picture: |  |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Product type: | Proteins |
| Host species: | Wheat Germ (in vitro) |
| Antigen species / target species: | Human |
| Applications: | AP,Array,ELISA,WB-Re |
| Shipping condition: | Dry Ice |