Cart 67 Product Products 27 010,06 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x CD15...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
27 010,06 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 67 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 27 010,06 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 27 010,06 €
Data sheet of PCSK1N monoclonal antibody (M02), clone 1E9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about PCSK1N monoclonal antibody (M02), clone 1E9
| Brand: | Abnova |
| Reference: | H00027344-M02 |
| Product name: | PCSK1N monoclonal antibody (M02), clone 1E9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PCSK1N. |
| Clone: | 1E9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 27344 |
| Gene name: | PCSK1N |
| Gene alias: | PROSAAS|SAAS |
| Gene description: | proprotein convertase subtilisin/kexin type 1 inhibitor |
| Genbank accession: | NM_013271 |
| Immunogen: | PCSK1N (NP_037403.1, 173 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DGPAGPDAEEAGDETPDVDPELLRYLLGRILAGSADSEGVAAPRRLRRAADHDVGSELPPEGVLGALLRVKRLETPAPQVPARRLLPP |
| Protein accession: | NP_037403.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.42 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to PCSK1N on formalin-fixed paraffin-embedded human cerebellum. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Pax6 Directly Down-Regulates Pcsk1n Expression Thereby Regulating PC1/3 Dependent Proinsulin Processing.Liu T, Zhao Y, Tang N, Feng R, Yang X, Lu N, Wen J, Li L. PLoS One. 2012;7(10):e46934. doi: 10.1371/journal.pone.0046934. Epub 2012 Oct 9. |