| Brand: | Abnova |
| Reference: | H00027339-M07 |
| Product name: | PRPF19 monoclonal antibody (M07), clone 2E5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PRPF19. |
| Clone: | 2E5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 27339 |
| Gene name: | PRPF19 |
| Gene alias: | NMP200|PRP19|PSO4|SNEV|UBOX4|hPSO4 |
| Gene description: | PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) |
| Genbank accession: | NM_014502 |
| Immunogen: | PRPF19 (NP_055317, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHPIRPKPPSATSIPAILKALQDEWDAVMLHSF |
| Protein accession: | NP_055317 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | PRPF19 monoclonal antibody (M07), clone 2E5. Western Blot analysis of PRPF19 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |