| Brand: | Abnova |
| Reference: | H00027328-M05 |
| Product name: | PCDH11X monoclonal antibody (M05), clone 7B4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PCDH11X. |
| Clone: | 7B4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 27328 |
| Gene name: | PCDH11X |
| Gene alias: | PCDH-X|PCDH11|PCDHX|PCDHY |
| Gene description: | protocadherin 11 X-linked |
| Genbank accession: | NM_032969 |
| Immunogen: | PCDH11X (NP_061850, 1228 a.a. ~ 1336 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AQASALCYSPPLAQAAAISHSSPLPQVIALHRSQAQSSVSLQQGWVQGADGLCSVDQGVQGSATSQFYTMSERLHPSDDSIKVIPLTTFTPRQQARPSRGDSPIMEEHP |
| Protein accession: | NP_061850 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PCDH11X monoclonal antibody (M05), clone 7B4. Western Blot analysis of PCDH11X expression in A-431. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |