View larger

TNRC6A monoclonal antibody (M05), clone 2A10

Reference:

Condition: New product

Data sheet of TNRC6A monoclonal antibody (M05), clone 2A10

Brand:	Abnova
Reference:	H00027327-M05
Product name:	TNRC6A monoclonal antibody (M05), clone 2A10
Product description:	Mouse monoclonal antibody raised against a partial recombinant TNRC6A.
Clone:	2A10
Isotype:	IgG2a Kappa
Gene id:	27327
Gene name:	TNRC6A
Gene alias:	CAGH26\|DKFZp666E117\|FLJ22043\|GW1\|GW182\|KIAA1460\|MGC75384\|TNRC6
Gene description:	trinucleotide repeat containing 6A
Genbank accession:	NM_014494
Immunogen:	TNRC6A (NP_055309, 254 a.a. ~ 353 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	MDADSASSSESERNITIMASGNTGGEKDGLRNSTGLGSQNKFVVGSSSNNVGHGSSTGPWGFSHGAIISTCQVSVDAPESKSESSNNRMNAWGTVSSSSN
Protein accession:	NP_055309
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (37.00 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Applications:	ELISA,WB-Re
Shipping condition:	Dry Ice