Cart 36 Product Products 12 006,51 € (empty)
No products
To be determined Shipping
12 006,51 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 36 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 12 006,51 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 12 006,51 €
Data sheet of PGDS purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host species | Mouse |
| Applications | WB-Tr |
More info about PGDS purified MaxPab mouse polyclonal antibody (B01P)
| Reference: | H00027306-B01P |
| Product name: | PGDS purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human PGDS protein. |
| Gene id: | 27306 |
| Gene name: | PGDS |
| Gene alias: | - |
| Gene description: | prostaglandin D2 synthase, hematopoietic |
| Genbank accession: | NM_014485.2 |
| Immunogen: | PGDS (NP_055300.1, 1 a.a. ~ 199 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL |
| Protein accession: | NP_055300.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Shipping condition: | Dry Ice |