| Reference: | H00027306-B01P |
| Product name: | PGDS purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human PGDS protein. |
| Gene id: | 27306 |
| Gene name: | PGDS |
| Gene alias: | - |
| Gene description: | prostaglandin D2 synthase, hematopoietic |
| Genbank accession: | NM_014485.2 |
| Immunogen: | PGDS (NP_055300.1, 1 a.a. ~ 199 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL |
| Protein accession: | NP_055300.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Shipping condition: | Dry Ice |