| Brand: | Abnova |
| Reference: | H00027303-M02 |
| Product name: | RBMS3 monoclonal antibody (M02), clone 3B11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RBMS3. |
| Clone: | 3B11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 27303 |
| Gene name: | RBMS3 |
| Gene alias: | - |
| Gene description: | RNA binding motif, single stranded interacting protein |
| Genbank accession: | NM_014483.3 |
| Immunogen: | RBMS3 (NP_055298.2, 311 a.a. ~ 420 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QPTGAVITPTMDHPMSMQPANMMGPLTQQMNHLSLGTTGTYMTAAAPMQGTYIPQYTPVPPTAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAVDTSNEHAPAYSYQQSK |
| Protein accession: | NP_055298 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |