| Brand: | Abnova |
| Reference: | H00027299-M01 |
| Product name: | ADAMDEC1 monoclonal antibody (M01), clone 6C4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ADAMDEC1. |
| Clone: | 6C4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 27299 |
| Gene name: | ADAMDEC1 |
| Gene alias: | M12.219 |
| Gene description: | ADAM-like, decysin 1 |
| Genbank accession: | NM_014479 |
| Immunogen: | ADAMDEC1 (NP_055294, 361 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCLLQAPIPTNIMTTPVCGNHLLEVGEDCDCGSPKECTNLCCEALTCKLKPGTDCGGDAPNHTTE |
| Protein accession: | NP_055294 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to ADAMDEC1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Gene Expression Profiling Identifies MMP-12 and ADAMDEC1 as Potential Pathogenic Mediators of Pulmonary Sarcoidosis.Crouser ED, Culver DA, Knox KS, Julian MW, Shao G, Abraham S, Liyanarachchi S, Macre JE, Wewers MD, Gavrilin MA, Ross P, Abbas A, Eng C. Am J Respir Crit Care Med. 2009 May 15;179(10):929-38. Epub 2009 Feb 12. |