RCP9 polyclonal antibody (A01) View larger

RCP9 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RCP9 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about RCP9 polyclonal antibody (A01)

Brand: Abnova
Reference: H00027297-A01
Product name: RCP9 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant RCP9.
Gene id: 27297
Gene name: CRCP
Gene alias: CGRP-RCP|MGC111194|RCP|RCP9
Gene description: CGRP receptor component
Genbank accession: NM_014478
Immunogen: RCP9 (NP_055293, 39 a.a. ~ 148 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: QQNLNTITYETLKYISKTPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNVAMDEEDPA
Protein accession: NP_055293
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00027297-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.21 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00027297-A01-1-1-1.jpg
Application image note: RCP9 polyclonal antibody (A01), Lot # 051018JC01 Western Blot analysis of RCP9 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RCP9 polyclonal antibody (A01) now

Add to cart