Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00027293-M01 |
Product name: | SMPDL3B monoclonal antibody (M01), clone 5E12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SMPDL3B. |
Clone: | 5E12 |
Isotype: | IgG3 Kappa |
Gene id: | 27293 |
Gene name: | SMPDL3B |
Gene alias: | ASML3B |
Gene description: | sphingomyelin phosphodiesterase, acid-like 3B |
Genbank accession: | NM_001009568 |
Immunogen: | SMPDL3B (NP_001009568, 274 a.a. ~ 372 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | FFGHHHTDSFRMLYDDAGVPISAMFITPGVTPWKTTLPGVVNGANNPAIRVFEYDRATLSLKVRSPAEARGGGWEGLKCITTFPHSQLIHLPLTTEPQE |
Protein accession: | NP_001009568 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of SMPDL3B expression in transfected 293T cell line by SMPDL3B monoclonal antibody (M01), clone 5E12. Lane 1: SMPDL3B transfected lysate(41.7 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |