SMPDL3B monoclonal antibody (M01), clone 5E12 View larger

SMPDL3B monoclonal antibody (M01), clone 5E12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMPDL3B monoclonal antibody (M01), clone 5E12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about SMPDL3B monoclonal antibody (M01), clone 5E12

Brand: Abnova
Reference: H00027293-M01
Product name: SMPDL3B monoclonal antibody (M01), clone 5E12
Product description: Mouse monoclonal antibody raised against a partial recombinant SMPDL3B.
Clone: 5E12
Isotype: IgG3 Kappa
Gene id: 27293
Gene name: SMPDL3B
Gene alias: ASML3B
Gene description: sphingomyelin phosphodiesterase, acid-like 3B
Genbank accession: NM_001009568
Immunogen: SMPDL3B (NP_001009568, 274 a.a. ~ 372 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: FFGHHHTDSFRMLYDDAGVPISAMFITPGVTPWKTTLPGVVNGANNPAIRVFEYDRATLSLKVRSPAEARGGGWEGLKCITTFPHSQLIHLPLTTEPQE
Protein accession: NP_001009568
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00027293-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00027293-M01-13-15-1.jpg
Application image note: Western Blot analysis of SMPDL3B expression in transfected 293T cell line by SMPDL3B monoclonal antibody (M01), clone 5E12.

Lane 1: SMPDL3B transfected lysate(41.7 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SMPDL3B monoclonal antibody (M01), clone 5E12 now

Add to cart