| Brand: | Abnova |
| Reference: | H00027285-M02 |
| Product name: | TEKT2 monoclonal antibody (M02), clone 2H4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TEKT2. |
| Clone: | 2H4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 27285 |
| Gene name: | TEKT2 |
| Gene alias: | TEKTB1|TEKTIN-T|h-tektin-t |
| Gene description: | tektin 2 (testicular) |
| Genbank accession: | NM_014466 |
| Immunogen: | TEKT2 (NP_055281, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MATLSVKPSRRFQLPDWHTNSYLLSTNAQLQRDASHQIRQEARVLRNETNNQTIWDEHDNRTRLVERIDTVNRWKEMLDKCLTDLDAEIDALTQMKESA |
| Protein accession: | NP_055281 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | TEKT2 monoclonal antibody (M02), clone 2H4. Western Blot analysis of TEKT2 expression in HeLa. |
| Applications: | WB-Ce,WB-Ti,ELISA,WB-Re |
| Shipping condition: | Dry Ice |