| Brand:  | Abnova | 
| Reference:  | H00027285-M02 | 
| Product name:  | TEKT2 monoclonal antibody (M02), clone 2H4 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant TEKT2. | 
| Clone:  | 2H4 | 
| Isotype:  | IgG2a Kappa | 
| Gene id:  | 27285 | 
| Gene name:  | TEKT2 | 
| Gene alias:  | TEKTB1|TEKTIN-T|h-tektin-t | 
| Gene description:  | tektin 2 (testicular) | 
| Genbank accession:  | NM_014466 | 
| Immunogen:  | TEKT2 (NP_055281, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | MATLSVKPSRRFQLPDWHTNSYLLSTNAQLQRDASHQIRQEARVLRNETNNQTIWDEHDNRTRLVERIDTVNRWKEMLDKCLTDLDAEIDALTQMKESA | 
| Protein accession:  | NP_055281 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (36.63 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | TEKT2 monoclonal antibody (M02), clone 2H4. Western Blot analysis of TEKT2 expression in HeLa. | 
| Applications:  | WB-Ce,WB-Ti,ELISA,WB-Re | 
| Shipping condition:  | Dry Ice |