Cart 5 Product Products 2 077,90 € (empty)
No products
To be determined Shipping
2 077,90 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 5 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 2 077,90 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 2 077,90 €
Data sheet of SULT1B1 monoclonal antibody (M04A), clone 4C9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,IP |
More info about SULT1B1 monoclonal antibody (M04A), clone 4C9
| Brand: | Abnova |
| Reference: | H00027284-M04A |
| Product name: | SULT1B1 monoclonal antibody (M04A), clone 4C9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SULT1B1. |
| Clone: | 4C9 |
| Isotype: | IgM Kappa |
| Gene id: | 27284 |
| Gene name: | SULT1B1 |
| Gene alias: | MGC13356|ST1B2|SULT1B2 |
| Gene description: | sulfotransferase family, cytosolic, 1B, member 1 |
| Genbank accession: | NM_014465 |
| Immunogen: | SULT1B1 (NP_055280.2, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MLSPKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKCKRGFITEKVPMLEMTLPGLRTSGIEQLEK |
| Protein accession: | NP_055280.2 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoprecipitation of SULT1B1 transfected lysate using anti-SULT1B1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with SULT1B1 MaxPab rabbit polyclonal antibody. |
| Applications: | ELISA,WB-Re,IP |
| Shipping condition: | Dry Ice |