Brand: | Abnova |
Reference: | H00027258-M08 |
Product name: | LSM3 monoclonal antibody (M08), clone 4H3 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant LSM3. |
Clone: | 4H3 |
Isotype: | IgG2a Kappa |
Gene id: | 27258 |
Gene name: | LSM3 |
Gene alias: | SMX4|USS2|YLR438C |
Gene description: | LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae) |
Genbank accession: | BC007055 |
Immunogen: | LSM3 (AAH07055, 1 a.a. ~ 102 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG |
Protein accession: | AAH07055 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.96 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged LSM3 is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |