LSM3 monoclonal antibody (M08), clone 4H3 View larger

LSM3 monoclonal antibody (M08), clone 4H3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LSM3 monoclonal antibody (M08), clone 4H3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about LSM3 monoclonal antibody (M08), clone 4H3

Brand: Abnova
Reference: H00027258-M08
Product name: LSM3 monoclonal antibody (M08), clone 4H3
Product description: Mouse monoclonal antibody raised against a full-length recombinant LSM3.
Clone: 4H3
Isotype: IgG2a Kappa
Gene id: 27258
Gene name: LSM3
Gene alias: SMX4|USS2|YLR438C
Gene description: LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae)
Genbank accession: BC007055
Immunogen: LSM3 (AAH07055, 1 a.a. ~ 102 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG
Protein accession: AAH07055
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00027258-M08-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.96 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00027258-M08-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged LSM3 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy LSM3 monoclonal antibody (M08), clone 4H3 now

Add to cart