Brand: | Abnova |
Reference: | H00027254-M01 |
Product name: | PIPPIN monoclonal antibody (M01), clone 2H8 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant PIPPIN. |
Clone: | 2H8 |
Isotype: | IgG1 Kappa |
Gene id: | 27254 |
Gene name: | CSDC2 |
Gene alias: | PIPPIN|dJ347H13.2 |
Gene description: | cold shock domain containing C2, RNA binding |
Genbank accession: | BC067113 |
Immunogen: | PIPPIN (AAH67113, 1 a.a. ~ 153 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLPTKRTRTYSATARASAGPVFKGVCKQFSRSQGHGFITPENGSEDIFVHVSDIEGEYVPVEGDEVTYKMCPIPPKNQKFQAVEVVLTQLAPHTPHETWSGQVVGS |
Protein accession: | AAH67113 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (42.57 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to CSDC2 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1.5 ug/ml] |
Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |