Cart 11 Product Products 4 341,54 € (empty)
-
-
-
1 x Nup160...259,07 € -
-
-
-
-
-
-
-
No products
To be determined Shipping
4 341,54 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 11 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 4 341,54 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 4 341,54 €
Data sheet of PIPPIN monoclonal antibody (M01), clone 2H8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,IF,S-ELISA,ELISA,WB-Re |
More info about PIPPIN monoclonal antibody (M01), clone 2H8
| Brand: | Abnova |
| Reference: | H00027254-M01 |
| Product name: | PIPPIN monoclonal antibody (M01), clone 2H8 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant PIPPIN. |
| Clone: | 2H8 |
| Isotype: | IgG1 Kappa |
| Gene id: | 27254 |
| Gene name: | CSDC2 |
| Gene alias: | PIPPIN|dJ347H13.2 |
| Gene description: | cold shock domain containing C2, RNA binding |
| Genbank accession: | BC067113 |
| Immunogen: | PIPPIN (AAH67113, 1 a.a. ~ 153 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLPTKRTRTYSATARASAGPVFKGVCKQFSRSQGHGFITPENGSEDIFVHVSDIEGEYVPVEGDEVTYKMCPIPPKNQKFQAVEVVLTQLAPHTPHETWSGQVVGS |
| Protein accession: | AAH67113 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (42.57 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to CSDC2 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1.5 ug/ml] |
| Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |