No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
| Brand: | Abnova |
| Reference: | H00027242-M56 |
| Product name: | TNFRSF21 monoclonal antibody (M56), clone 8F5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TNFRSF21. |
| Clone: | 8F5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 27242 |
| Gene name: | TNFRSF21 |
| Gene alias: | BM-018|DR6|MGC31965 |
| Gene description: | tumor necrosis factor receptor superfamily, member 21 |
| Genbank accession: | BC017730.1 |
| Immunogen: | TNFRSF21 (AAH17730.1, 89 a.a. ~ 170 a.a) partial recombinant protein. |
| Immunogen sequence/protein sequence: | SSCPVGTFTRHENGIEKCHDCSQPCPWPMIEKLPCAALTDRECTCPPGMFQSNATCAPHTVCPVGWGVRKKGTETEDVRCKQ |
| Protein accession: | AAH17730.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |