TNFRSF21 monoclonal antibody (M55), clone 6D11 View larger

TNFRSF21 monoclonal antibody (M55), clone 6D11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TNFRSF21 monoclonal antibody (M55), clone 6D11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about TNFRSF21 monoclonal antibody (M55), clone 6D11

Brand: Abnova
Reference: H00027242-M55
Product name: TNFRSF21 monoclonal antibody (M55), clone 6D11
Product description: Mouse monoclonal antibody raised against a partial recombinant TNFRSF21.
Clone: 6D11
Isotype: IgG1 Kappa
Gene id: 27242
Gene name: TNFRSF21
Gene alias: BM-018|DR6|MGC31965
Gene description: tumor necrosis factor receptor superfamily, member 21
Genbank accession: BC017730.1
Immunogen: TNFRSF21 (AAH17730.1, 89 a.a. ~ 170 a.a) partial recombinant protein.
Immunogen sequence/protein sequence: SSCPVGTFTRHENGIEKCHDCSQPCPWPMIEKLPCAALTDRECTCPPGMFQSNATCAPHTVCPVGWGVRKKGTETEDVRCKQ
Protein accession: AAH17730.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy TNFRSF21 monoclonal antibody (M55), clone 6D11 now

Add to cart