| Brand:  | Abnova | 
| Reference:  | H00027242-M48 | 
| Product name:  | TNFRSF21 monoclonal antibody (M48), clone 4D8 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant TNFRSF21. | 
| Clone:  | 4D8 | 
| Isotype:  | IgG1 Kappa | 
| Gene id:  | 27242 | 
| Gene name:  | TNFRSF21 | 
| Gene alias:  | BM-018|DR6|MGC31965 | 
| Gene description:  | tumor necrosis factor receptor superfamily, member 21 | 
| Genbank accession:  | BC017730.1 | 
| Immunogen:  | TNFRSF21 (AAH17730.1, 47 a.a. ~ 214 a.a) partial recombinant protein. | 
| Immunogen sequence/protein sequence:  | ASNLIGTYRHVDRATGQVLTCDKCPAGTYVSEHCTNTSLRVCSSCPVGTFTRHENGIEKCHDCSQPCPWPMIEKLPCAALTDRECTCPPGMFQSNATCAPHTVCPVGWGVRKKGTETEDVRCKQCARGTFSDVPSSVMKCKAYTDCLSQNLVVIKPGTKETDNVCGTL | 
| Protein accession:  | AAH17730.1 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Applications:  | ELISA | 
| Shipping condition:  | Dry Ice |