No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA |
Brand: | Abnova |
Reference: | H00027242-M41 |
Product name: | TNFRSF21 monoclonal antibody (M41), clone 4C4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TNFRSF21. |
Clone: | 4C4 |
Isotype: | IgG2a Kappa |
Gene id: | 27242 |
Gene name: | TNFRSF21 |
Gene alias: | BM-018|DR6|MGC31965 |
Gene description: | tumor necrosis factor receptor superfamily, member 21 |
Genbank accession: | BC017730.1 |
Immunogen: | TNFRSF21 (AAH17730.1, 47 a.a. ~ 214 a.a) partial recombinant protein. |
Immunogen sequence/protein sequence: | ASNLIGTYRHVDRATGQVLTCDKCPAGTYVSEHCTNTSLRVCSSCPVGTFTRHENGIEKCHDCSQPCPWPMIEKLPCAALTDRECTCPPGMFQSNATCAPHTVCPVGWGVRKKGTETEDVRCKQCARGTFSDVPSSVMKCKAYTDCLSQNLVVIKPGTKETDNVCGTL |
Protein accession: | AAH17730.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |