| Brand: | Abnova |
| Reference: | H00027233-M01 |
| Product name: | SULT1C2 monoclonal antibody (M01), clone 4D9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SULT1C2. |
| Clone: | 4D9 |
| Isotype: | IgG2b Kappa |
| Gene id: | 27233 |
| Gene name: | SULT1C4 |
| Gene alias: | MGC149521|MGC34422|SULT1C|SULT1C2 |
| Gene description: | sulfotransferase family, cytosolic, 1C, member 4 |
| Genbank accession: | BC058861 |
| Immunogen: | SULT1C2 (AAH58861.1, 1 a.a. ~ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MALHDMEDFTFDGTKRLSVNYVKGILQPTDTCDIWDKIWNFQAKPDDLLISTYPKAGTTWTQEIVELIQNEGDVEKSKRAPTHQRFPFLEMKIPSLGSGEYK |
| Protein accession: | AAH58861.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.96 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged SULT1C4 is 0.3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |