IL17B monoclonal antibody (M01), clone 6G5 View larger

IL17B monoclonal antibody (M01), clone 6G5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IL17B monoclonal antibody (M01), clone 6G5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about IL17B monoclonal antibody (M01), clone 6G5

Brand: Abnova
Reference: H00027190-M01
Product name: IL17B monoclonal antibody (M01), clone 6G5
Product description: Mouse monoclonal antibody raised against a partial recombinant IL17B.
Clone: 6G5
Isotype: IgG2a Kappa
Gene id: 27190
Gene name: IL17B
Gene alias: IL-17B|IL-20|MGC138900|MGC138901|ZCYTO7
Gene description: interleukin 17B
Genbank accession: NM_014443
Immunogen: IL17B (NP_055258, 23 a.a. ~ 122 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCL
Protein accession: NP_055258
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00027190-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00027190-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged IL17B is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy IL17B monoclonal antibody (M01), clone 6G5 now

Add to cart