Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SIGLEC8 (Human) Recombinant Protein (Q01)
| Brand | Abnova |
| Product type | Proteins |
| Host species | Wheat Germ (in vitro) |
| Applications | AP,Array,ELISA,WB-Re |
More info about SIGLEC8 (Human) Recombinant Protein (Q01)
| Brand: | Abnova |
| Reference: | H00027181-Q01 |
| Product name: | SIGLEC8 (Human) Recombinant Protein (Q01) |
| Product description: | Human SIGLEC8 partial ORF ( NP_055257, 18 a.a. - 121 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 27181 |
| Gene name: | SIGLEC8 |
| Gene alias: | MGC59785|SAF2|SIGLEC-8|SIGLEC8L |
| Gene description: | sialic acid binding Ig-like lectin 8 |
| Genbank accession: | NM_014442 |
| Immunogen sequence/protein sequence: | EGDRQYGDGYLLQVQELVTVQEGLCVHVPCSFSYPQDGWTDSDPVHGYWFRAGDRPYQDAPVATNNPDREVQAETQGRFQLLGDIWSNDCSLSIRDARKRDKGS |
| Protein accession: | NP_055257 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quality control testing picture: |  |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Product type: | Proteins |
| Host species: | Wheat Germ (in vitro) |
| Antigen species / target species: | Human |
| Applications: | AP,Array,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Intravenous immunoglobulin preparations contain anti-Siglec-8 autoantibodies.von Gunten S, Vogel M, Schaub A, Stadler BM, Miescher S, Crocker PR, Simon HU. J Allergy Clin Immunol. 2007 Apr;119(4):1005-11. Epub 2007 Mar 2. |