| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
| Brand: | Abnova |
| Reference: | H00027179-B01P |
| Product name: | IL1F6 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human IL1F6 protein. |
| Gene id: | 27179 |
| Gene name: | IL1F6 |
| Gene alias: | FIL1|FIL1(EPSILON)|FIL1E|IL-1F6|IL1(EPSILON)|MGC129552|MGC129553 |
| Gene description: | interleukin 1 family, member 6 (epsilon) |
| Genbank accession: | NM_014440.1 |
| Immunogen: | IL1F6 (NP_055255.1, 1 a.a. ~ 158 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF |
| Protein accession: | NP_055255.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of IL1F6 expression in transfected 293T cell line (H00027179-T01) by IL1F6 MaxPab polyclonal antibody. Lane 1: IL1F6 transfected lysate(17.38 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |