| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Tr |
| Brand: | Abnova |
| Reference: | H00027177-M01 |
| Product name: | IL1F8 monoclonal antibody (M01), clone 1E4 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant IL1F8. |
| Clone: | 1E4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 27177 |
| Gene name: | IL1F8 |
| Gene alias: | FIL1|FIL1-(ETA)|FIL1H|IL-1F8|IL-1H2|IL1-ETA|IL1H2|MGC126880|MGC126882 |
| Gene description: | interleukin 1 family, member 8 (eta) |
| Genbank accession: | NM_173178.1 |
| Immunogen: | IL1F8 (NP_775270.1, 1 a.a. ~ 157 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MNPQREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE |
| Protein accession: | NP_775270.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of IL1F8 expression in transfected 293T cell line by IL1F8 monoclonal antibody (M01), clone 1E4. Lane 1: IL1F8 transfected lysate(17.7 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Tr |
| Shipping condition: | Dry Ice |