Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NAAA monoclonal antibody (M02), clone 3F4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr,IP |
More info about NAAA monoclonal antibody (M02), clone 3F4
| Brand: | Abnova |
| Reference: | H00027163-M02 |
| Product name: | NAAA monoclonal antibody (M02), clone 3F4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NAAA. |
| Clone: | 3F4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 27163 |
| Gene name: | NAAA |
| Gene alias: | ASAHL|PLT |
| Gene description: | N-acylethanolamine acid amidase |
| Genbank accession: | NM_014435 |
| Immunogen: | NAAA (NP_055250, 36 a.a. ~ 104 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | FNVSLDSVPELRWLPVLRHYDLDLVRAAMAQVIGDRVPKWVHVLIGKVVLELERFLPQPFTGEIRGMCD |
| Protein accession: | NP_055250 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.33 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of NAAA expression in transfected 293T cell line by NAAA monoclonal antibody (M02), clone 3F4. Lane 1: NAAA transfected lysate(22 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |