| Brand:  | Abnova | 
| Reference:  | H00027161-M05 | 
| Product name:  | EIF2C2 monoclonal antibody (M05), clone 2H2 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant EIF2C2. | 
| Clone:  | 2H2 | 
| Isotype:  | IgG2a Kappa | 
| Gene id:  | 27161 | 
| Gene name:  | EIF2C2 | 
| Gene alias:  | AGO2|MGC3183|Q10 | 
| Gene description:  | eukaryotic translation initiation factor 2C, 2 | 
| Genbank accession:  | NM_012154 | 
| Immunogen:  | EIF2C2 (NP_036286.2, 381 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | KLMRSASFNTDPYVREFGIMVKDEMTDVTGRVLQPPSILYGGRNKAIATPVQGVWDMRNKQFHTGIEIKVWAIACFAPQRQCTEVHLKSFTEQLRKISRD | 
| Protein accession:  | NP_036286.2 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (36.74 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Applications:  | ELISA,WB-Re | 
| Shipping condition:  | Dry Ice |