View larger

CHIA purified MaxPab rabbit polyclonal antibody (D01P)

Reference:

Condition: New product

Data sheet of CHIA purified MaxPab rabbit polyclonal antibody (D01P)

Brand	Abnova
Product type	Primary antibodies
Reactivity	Human,Mouse
Host species	Rabbit
Applications	WB-Ti,WB-Tr

More info about CHIA purified MaxPab rabbit polyclonal antibody (D01P)

Brand:	Abnova
Reference:	H00027159-D01P
Product name:	CHIA purified MaxPab rabbit polyclonal antibody (D01P)
Product description:	Rabbit polyclonal antibody raised against a full-length human CHIA protein.
Gene id:	27159
Gene name:	CHIA
Gene alias:	2200003E03Rik\|AMCase\|CHIT2\|DKFZp313J1722\|RP5-1125M8.1\|TSA1902
Gene description:	chitinase, acidic
Genbank accession:	NM_021797.2
Immunogen:	CHIA (NP_068569.2, 1 a.a. ~ 368 a.a) full-length human protein.
Immunogen sequence/protein sequence:	MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNIKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPAQPIEPITAAPSGSGNGSGSSSSGGSSGGSGFCAVRANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNWA
Protein accession:	NP_068569.2
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody reactive against mammalian transfected lysate.
Product type:	Primary antibodies
Host species:	Rabbit
Antigen species / target species:	Human
Reactivity:	Human,Mouse
Application image:
Application image note:	Western Blot analysis of CHIA expression in transfected 293T cell line (H00027159-T01) by CHIA MaxPab polyclonal antibody. Lane 1: CHIA transfected lysate(40.10 KDa). Lane 2: Non-transfected lysate.
Applications:	WB-Ti,WB-Tr
Shipping condition:	Dry Ice

Reviews

Be the first to write your review !

Buy CHIA purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart