| Brand: | Abnova |
| Reference: | H00027158-M02 |
| Product name: | NDOR1 monoclonal antibody (M02), clone 5A7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NDOR1. |
| Clone: | 5A7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 27158 |
| Gene name: | NDOR1 |
| Gene alias: | MGC138148|NR1|bA350O14.9 |
| Gene description: | NADPH dependent diflavin oxidoreductase 1 |
| Genbank accession: | NM_014434 |
| Immunogen: | NDOR1 (NP_055249, 498 a.a. ~ 595 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EWQELEKRDCLTLIPAFSREQEQKVYVQHRLRELGSLVWELLDRQGAYFYLAGNAKSMPADVSEALMSIFQEEGGLCSPDAAAYLARLQQTRRFQTET |
| Protein accession: | NP_055249 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | NDOR1 monoclonal antibody (M02), clone 5A7. Western Blot analysis of NDOR1 expression in HeLa(Cat # L013V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |