Cart 47 Product Products 17 649,40 € (empty)
No products
To be determined Shipping
17 649,40 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 47 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 17 649,40 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 17 649,40 €
Data sheet of NDOR1 monoclonal antibody (M01), clone 3A11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about NDOR1 monoclonal antibody (M01), clone 3A11
| Brand: | Abnova |
| Reference: | H00027158-M01 |
| Product name: | NDOR1 monoclonal antibody (M01), clone 3A11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NDOR1. |
| Clone: | 3A11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 27158 |
| Gene name: | NDOR1 |
| Gene alias: | MGC138148|NR1|bA350O14.9 |
| Gene description: | NADPH dependent diflavin oxidoreductase 1 |
| Genbank accession: | NM_014434 |
| Immunogen: | NDOR1 (NP_055249, 498 a.a. ~ 595 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EWQELEKRDCLTLIPAFSREQEQKVYVQHRLRELGSLVWELLDRQGAYFYLAGNAKSMPADVSEALMSIFQEEGGLCSPDAAAYLARLQQTRRFQTET |
| Protein accession: | NP_055249 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | NDOR1 monoclonal antibody (M01), clone 3A11 Western Blot analysis of NDOR1 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Diflavin Oxidoreductases Activate the Bioreductive Prodrug PR-104A under Hypoxia.Guise CP, Abbattista MR, Tipparaju SR, Lambie NK, Su J, Li D, Wilson WR, Dachs GU, Patterson AV. Mol Pharmacol. 2012 Jan;81(1):31-40. Epub 2011 Oct 7. |