Cart 54 Product Products 20 047,20 € (empty)
No products
To be determined Shipping
20 047,20 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 54 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 20 047,20 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 20 047,20 €
Data sheet of MORC1 monoclonal antibody (M09), clone 3E8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about MORC1 monoclonal antibody (M09), clone 3E8
| Brand: | Abnova |
| Reference: | H00027136-M09 |
| Product name: | MORC1 monoclonal antibody (M09), clone 3E8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MORC1. |
| Clone: | 3E8 |
| Isotype: | IgG1 Kappa |
| Gene id: | 27136 |
| Gene name: | MORC1 |
| Gene alias: | MORC|ZCW6 |
| Gene description: | MORC family CW-type zinc finger 1 |
| Genbank accession: | NM_014429 |
| Immunogen: | MORC1 (NP_055244, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MDDRYPALQRAQLRLDFIHANSTTHSFLFGALAELLDNARDAGAERLDVFSVDNEKLQGGFMLCFLDDGCGMSPEEASDIIYFGRSKKRLSTLKFIGQYG |
| Protein accession: | NP_055244 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | MORC1 monoclonal antibody (M09), clone 3E8. Western Blot analysis of MORC1 expression in HepG2(Cat # L019V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |