Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of INVS polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about INVS polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00027130-A01 |
| Product name: | INVS polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant INVS. |
| Gene id: | 27130 |
| Gene name: | INVS |
| Gene alias: | INV|KIAA0573|MGC133080|MGC133081|NPH2|NPHP2 |
| Gene description: | inversin |
| Genbank accession: | NM_014425 |
| Immunogen: | INVS (NP_055240, 1 a.a. ~ 91 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MNKSENLLFAGSSLASQVHAAAVNGDKGALQRLIVGNSALKDKEDQFGRTPLMYCVLADRLDCADALLKAGADVNKTDHSQRTALHLAAQK |
| Protein accession: | NP_055240 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.12 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Altered modulation of WNT-beta-catenin and PI3K/Akt pathways in IgA nephropathy.Cox SN, Sallustio F, Serino G, Pontrelli P, Verrienti R, Pesce F, Torres DD, Ancona N, Stifanelli P, Zaza G, Schena FP. Kidney Int. 2010 Aug;78(4):396-407. Epub 2010 May 19. |