| Brand: | Abnova |
| Reference: | H00027127-M01 |
| Product name: | SMC1L2 monoclonal antibody (M01), clone 6A10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SMC1L2. |
| Clone: | 6A10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 27127 |
| Gene name: | SMC1B |
| Gene alias: | FLJ43748|SMC1BETA|SMC1L2|bK268H5|bK268H5.5 |
| Gene description: | structural maintenance of chromosomes 1B |
| Genbank accession: | NM_148674 |
| Immunogen: | SMC1L2 (NP_683515, 551 a.a. ~ 660 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KVAKDCIRFLKEERAEPETFLALDYLDIKPINERLRELKGCKMVIDVIKTQFPQLKKVIQFVCGNGLVCETMEEARHIALSGPERQKTVALDGTLFLKSGVISGGSSDLK |
| Protein accession: | NP_683515 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to SMC1B on HeLa cell . [antibody concentration 10 ug/ml] |
| Applications: | IF,ELISA,WB-Re |
| Shipping condition: | Dry Ice |